Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P22694-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MGNAATAK PA
1
10-17 (8) GSEVESVK PA
1
31-46 (16) WENPTQNNAGLEDFER PA
9
49-57 (9) TLGTGSFGR PA
11
65-73 (9) ATEQYYAMK PA
9
85-93 (9) QIEHTLNEK PA
10
95-106 (12) ILQAVNFPFLVR PA
8
113-134 (22) DNSNLYMVMEYVPGGEMFSHLR PA
11
146-166 (21) FYAAQIVLTFEYLHSLDLIYR PA
11
167-190 (24) DLKPENLLIDHQGYIQVTDFGFAK PA
9
196-214 (19) TWTLCGTPEYLAPEIILSK PA
12
219-250 (32) AVDWWALGVLIYEMAAGYPPFFADQPIQIYEK PA
11
258-267 (10) FPSHFSSDLK PA
10
272-280 (9) NLLQVDLTK PA
10
297-309 (13) WFATTDWIAIYQR PA
10
311-318 (8) VEAPFIPK PA
11
321-337 (17) GSGDTSNFDDYEEEDIR PA
8
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center