Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P22694-10)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-20 (15) SSDASACSSSEISVK PA
2
34-49 (16) WENPTQNNAGLEDFER PA
9
52-60 (9) TLGTGSFGR PA
11
68-76 (9) ATEQYYAMK PA
9
83-104 (22) DNSNLYMVMEYVPGGEMFSHLR PA
11
116-136 (21) FYAAQIVLTFEYLHSLDLIYR PA
11
137-160 (24) DLKPENLLIDHQGYIQVTDFGFAK PA
9
166-184 (19) TWTLCGTPEYLAPEIILSK PA
12
189-220 (32) AVDWWALGVLIYEMAAGYPPFFADQPIQIYEK PA
11
228-237 (10) FPSHFSSDLK PA
10
242-250 (9) NLLQVDLTK PA
10
267-279 (13) WFATTDWIAIYQR PA
10
281-288 (8) VEAPFIPK PA
11
291-307 (17) GSGDTSNFDDYEEEDIR PA
8
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center