Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P22694-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-21 (16) EPPCNQYTGTTTALQK PA
0
43-61 (19) TALENDSLHFSEHTALWDR PA
0
78-93 (16) WENPTQNNAGLEDFER PA
9
96-104 (9) TLGTGSFGR PA
11
112-120 (9) ATEQYYAMK PA
9
132-140 (9) QIEHTLNEK PA
10
142-153 (12) ILQAVNFPFLVR PA
8
160-181 (22) DNSNLYMVMEYVPGGEMFSHLR PA
11
193-213 (21) FYAAQIVLTFEYLHSLDLIYR PA
11
214-237 (24) DLKPENLLIDHQGYIQVTDFGFAK PA
9
243-261 (19) TWTLCGTPEYLAPEIILSK PA
12
266-297 (32) AVDWWALGVLIYEMAAGYPPFFADQPIQIYEK PA
11
305-314 (10) FPSHFSSDLK PA
10
319-327 (9) NLLQVDLTK PA
10
344-356 (13) WFATTDWIAIYQR PA
10
358-365 (8) VEAPFIPK PA
11
368-384 (17) GSGDTSNFDDYEEEDIR PA
8
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center