Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P22694-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
19-34 (16) WENPTQNNAGLEDFER PA
9
37-45 (9) TLGTGSFGR PA
11
53-61 (9) ATEQYYAMK PA
9
73-81 (9) QIEHTLNEK PA
10
83-94 (12) ILQAVNFPFLVR PA
8
101-122 (22) DNSNLYMVMEYVPGGEMFSHLR PA
11
134-154 (21) FYAAQIVLTFEYLHSLDLIYR PA
11
155-178 (24) DLKPENLLIDHQGYIQVTDFGFAK PA
9
184-202 (19) TWTLCGTPEYLAPEIILSK PA
12
207-238 (32) AVDWWALGVLIYEMAAGYPPFFADQPIQIYEK PA
11
246-255 (10) FPSHFSSDLK PA
10
260-268 (9) NLLQVDLTK PA
10
285-297 (13) WFATTDWIAIYQR PA
10
299-306 (8) VEAPFIPK PA
11
309-325 (17) GSGDTSNFDDYEEEDIR PA
8
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center