Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P22694-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
18-33 (16) WENPTQNNAGLEDFER PA
9
36-44 (9) TLGTGSFGR PA
11
52-60 (9) ATEQYYAMK PA
9
72-80 (9) QIEHTLNEK PA
10
82-93 (12) ILQAVNFPFLVR PA
8
100-121 (22) DNSNLYMVMEYVPGGEMFSHLR PA
11
133-153 (21) FYAAQIVLTFEYLHSLDLIYR PA
11
154-177 (24) DLKPENLLIDHQGYIQVTDFGFAK PA
9
183-201 (19) TWTLCGTPEYLAPEIILSK PA
12
206-237 (32) AVDWWALGVLIYEMAAGYPPFFADQPIQIYEK PA
11
245-254 (10) FPSHFSSDLK PA
10
259-267 (9) NLLQVDLTK PA
10
284-296 (13) WFATTDWIAIYQR PA
10
298-305 (8) VEAPFIPK PA
11
308-324 (17) GSGDTSNFDDYEEEDIR PA
8
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center