Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P22694-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-20 (15) SSDASACSSSEISVK PA
2
34-49 (16) WENPTQNNAGLEDFER PA
9
52-60 (9) TLGTGSFGR PA
11
68-76 (9) ATEQYYAMK PA
9
88-96 (9) QIEHTLNEK PA
10
98-109 (12) ILQAVNFPFLVR PA
8
116-137 (22) DNSNLYMVMEYVPGGEMFSHLR PA
11
149-169 (21) FYAAQIVLTFEYLHSLDLIYR PA
11
170-193 (24) DLKPENLLIDHQGYIQVTDFGFAK PA
9
199-217 (19) TWTLCGTPEYLAPEIILSK PA
12
222-253 (32) AVDWWALGVLIYEMAAGYPPFFADQPIQIYEK PA
11
261-270 (10) FPSHFSSDLK PA
10
275-283 (9) NLLQVDLTK PA
10
300-312 (13) WFATTDWIAIYQR PA
10
314-321 (8) VEAPFIPK PA
11
324-340 (17) GSGDTSNFDDYEEEDIR PA
8
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center