Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P22694-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-23 (18) SSDASACSSSEISDSFVK PA
1
37-52 (16) WENPTQNNAGLEDFER PA
9
55-63 (9) TLGTGSFGR PA
11
71-79 (9) ATEQYYAMK PA
9
91-99 (9) QIEHTLNEK PA
10
101-112 (12) ILQAVNFPFLVR PA
8
119-140 (22) DNSNLYMVMEYVPGGEMFSHLR PA
11
152-172 (21) FYAAQIVLTFEYLHSLDLIYR PA
11
173-196 (24) DLKPENLLIDHQGYIQVTDFGFAK PA
9
202-220 (19) TWTLCGTPEYLAPEIILSK PA
12
225-256 (32) AVDWWALGVLIYEMAAGYPPFFADQPIQIYEK PA
11
264-273 (10) FPSHFSSDLK PA
10
278-286 (9) NLLQVDLTK PA
10
303-315 (13) WFATTDWIAIYQR PA
10
317-324 (8) VEAPFIPK PA
11
327-343 (17) GSGDTSNFDDYEEEDIR PA
8
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center