Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P22694-7)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-21 (15) SSDASACSSSEISVK PA
2
35-50 (16) WENPTQNNAGLEDFER PA
9
53-61 (9) TLGTGSFGR PA
11
69-77 (9) ATEQYYAMK PA
9
89-97 (9) QIEHTLNEK PA
10
99-110 (12) ILQAVNFPFLVR PA
8
117-138 (22) DNSNLYMVMEYVPGGEMFSHLR PA
11
150-170 (21) FYAAQIVLTFEYLHSLDLIYR PA
11
171-194 (24) DLKPENLLIDHQGYIQVTDFGFAK PA
9
200-218 (19) TWTLCGTPEYLAPEIILSK PA
12
223-254 (32) AVDWWALGVLIYEMAAGYPPFFADQPIQIYEK PA
11
262-271 (10) FPSHFSSDLK PA
10
276-284 (9) NLLQVDLTK PA
10
301-313 (13) WFATTDWIAIYQR PA
10
315-322 (8) VEAPFIPK PA
11
325-341 (17) GSGDTSNFDDYEEEDIR PA
8
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center