Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P22694-9)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-24 (18) SSDASACSSSEISDSFVK PA
1
38-53 (16) WENPTQNNAGLEDFER PA
9
56-64 (9) TLGTGSFGR PA
11
72-80 (9) ATEQYYAMK PA
9
92-100 (9) QIEHTLNEK PA
10
102-113 (12) ILQAVNFPFLVR PA
8
120-141 (22) DNSNLYMVMEYVPGGEMFSHLR PA
11
153-173 (21) FYAAQIVLTFEYLHSLDLIYR PA
11
174-197 (24) DLKPENLLIDHQGYIQVTDFGFAK PA
9
203-221 (19) TWTLCGTPEYLAPEIILSK PA
12
226-257 (32) AVDWWALGVLIYEMAAGYPPFFADQPIQIYEK PA
11
265-274 (10) FPSHFSSDLK PA
10
279-287 (9) NLLQVDLTK PA
10
304-316 (13) WFATTDWIAIYQR PA
10
318-325 (8) VEAPFIPK PA
11
328-344 (17) GSGDTSNFDDYEEEDIR PA
8
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center