Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P23368-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-17 (11) VVSTTCTLACR PA
1
25-33 (9) GKPLMLNPR PA
1
37-45 (9) GMAFTLQER PA
1
46-57 (12) QMLGLQGLLPPK PA
1
58-67 (10) IETQDIQALR PA
1
82-91 (10) YIYIMGIQER PA
1
99-128 (30) ILQDDIESLMPIVYTPTVGLACSQYGHIFR PA
1
132-140 (9) GLFISISDR PA
1
145-156 (12) SIVDNWPENHVK PA
1
157-165 (9) AVVVTDGER PA
3
166-183 (18) ILGLGDLGVYGMGIPVGK PA
1
184-197 (14) LCLYTACAGIRPDR PA
1
198-214 (17) CLPVCIDVGTDNIALLK PA
1
215-224 (10) DPFYMGLYQK PA
1
228-240 (13) TQQYDDLIDEFMK PA
1
249-264 (16) NTLIQFEDFGNHNAFR PA
1
273-296 (24) YCTFNDDIQGTAAVALAGLLAAQK PA
1
297-306 (10) VISKPISEHK PA
1
307-339 (33) ILFLGAGEAALGIANLIVMSMVENGLSEQEAQK PA
1
358-397 (40) IDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGR PA
1
398-405 (8) LFTPDVIR PA
1
406-440 (35) AMASINERPVIFALSNPTAQAECTAEEAYTLTEGR PA
1
441-453 (13) CLFASGSPFGPVK PA
1
459-475 (17) VFTPGQGNNVYIFPGYR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center