Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P24863-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MAGNFWQSSHYLQWILDK PA
0
31-39 (9) FLSEEEYWK PA
0
40-56 (17) LQIFFTNVIQALGEHLK PA
0
59-70 (12) QQVIATATVYFK PA
0
80-96 (17) SIDPVLMAPTCVFLASK PA
0
97-107 (11) VEEFGVVSNTR PA
1
108-117 (10) LIAAATSVLK PA
1
132-178 (47) MNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWR PA
1
186-211 (26) TDLCLLYPPFMIALACLHVACVVQQK PA
1
215-226 (12) QWFAELSVDMEK PA
1
249-256 (8) EMATILSK PA
1
257-283 (27) MPKPKPPPNSEGEQGPNGSQNSSYSQS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center