Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P24863-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MAPTCVFLASK PA
0
12-22 (11) VEEFGVVSNTR PA
1
23-32 (10) LIAAATSVLK PA
1
47-93 (47) MNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWR PA
1
101-126 (26) TDLCLLYPPFMIALACLHVACVVQQK PA
1
130-141 (12) QWFAELSVDMEK PA
1
164-171 (8) EMATILSK PA
1
172-198 (27) MPKPKPPPNSEGEQGPNGSQNSSYSQS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center