Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P25100-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-66 (62) DLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAGSGEDNR PA
0
67-125 (59) SSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILSVACNR PA
0
126-166 (41) HLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGR PA
0
167-194 (28) AFCDVWAAVDVLCCTASILSLCTISVDR PA
0
204-211 (8) YPAIMTER PA
0
213-236 (24) AAAILALLWVVALVVSVGPLLGWK PA
0
237-244 (8) EPVPPDER PA
0
245-276 (32) FCGITEEAGYAVFSSVCSFYLPMAVIVVMYCR PA
0
310-322 (13) GAATGADGAHGMR PA
0
349-385 (37) TLAIVVGVFVLCWFPFFFVLPLGSLFPQLKPSEGVFK PA
0
386-407 (22) VIFWLGYFNSCVNPLIYPCSSR PA
0
447-487 (41) QDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEMQAPVASR PA
0
529-536 (8) AEAACAQR PA
0
537-568 (32) SEVEAVSLGVPHEVAEGATCQAYELADYSNLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center