Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P25391-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-18 (16) GGVLLVLLLCVAAQCR PA
0
21-44 (24) GLFPAILNLASNAHISTNATCGEK PA
0
52-62 (11) LVEHVPGRPVR PA
0
68-77 (10) ICDGNSANPR PA
0
80-102 (23) HPISHAIDGTNNWWQSPSIQNGR PA
0
103-114 (12) EYHWVTITLDLR PA
0
115-125 (11) QVFQVAYVIIK PA
0
126-139 (14) AANAPRPGNWILER PA
0
140-162 (23) SLDGTTFSPWQYYAVSDSECLSR PA
0
176-188 (13) ADDEVICTSYYSR PA
0
189-214 (26) LVPLEHGEIHTSLINGRPSADDLSPK PA
0
215-222 (8) LLEFTSAR PA
0
233-244 (12) TLNADLMTLSHR PA
0
248-255 (8) ELDPIVTR PA
0
263-286 (24) DISVGGMCICYGHASSCPWDETTK PA
0
288-303 (16) LQCQCEHNTCGESCNR PA
0
304-332 (29) CCPGYHQQPWRPGTVSSGNTCEACNCHNK PA
0
335-344 (10) DCYYDESVAK PA
0
348-356 (9) SLNTAGQFR PA
0
357-385 (29) GGGVCINCLQNTMGINCETCIDGYYRPHK PA
0
386-411 (26) VSPYEDEPCRPCNCDPVGSLSSVCIK PA
0
412-422 (11) DDLHSDLHNGK PA
0
423-430 (8) QPGQCPCK PA
0
447-474 (28) DYPTCVSCGCNPVGSASDEPCTGPCVCK PA
0
485-493 (9) CKPGFYNLK PA
0
499-537 (39) GCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPR PA
0
539-549 (11) IPSQQDALGGR PA
0
550-562 (13) HQVSINNTAVMQR PA
0
567-579 (13) YYWAAPEAYLGNK PA
0
580-588 (9) LTAFGGFLK PA
0
589-613 (25) YTVSYDIPVETVDSNLMSHADVIIK PA
0
614-639 (26) GNGLTLSTQAEGLSLQPYEEYLNVVR PA
0
640-651 (12) LVPENFQDFHSK PA
0
657-672 (16) DQLMTVLANVTHLLIR PA
0
685-729 (45) LESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSCESCLSGYYR PA
0
730-782 (53) VDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGVHCEQCLPGFYGEPSR PA
0
783-830 (48) GTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCER PA
0
831-872 (42) CADGYYGNPTVPGESCVPCDCSGNVDPSEAGHCDSVTGECLK PA
0
873-884 (12) CLGNTDGAHCER PA
0
885-897 (13) CADGFYGDAVTAK PA
0
908-978 (71) GSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVSDGCTDEGQCHCVPGVAGK PA
0
983-1024 (42) CAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHTQGVK PA
0
1025-1055 (31) CEECEDGHWGYDAEVGCQACNCSLVGSTHHR PA
0
1056-1066 (11) CDVVTGHCQCK PA
0
1073-1082 (10) ACDQCSLGYR PA
0
1083-1095 (13) DFPDCVPCDCDLR PA
0
1096-1121 (26) GTSGDACNLEQGLCGCVEETGACPCK PA
0
1122-1133 (12) ENVFGPQCNECR PA
0
1141-1167 (27) ADNPLGCSPCFCSGLSHLCSELEDYVR PA
0
1168-1180 (13) TPVTLGSDQPLLR PA
0
1181-1188 (8) VVSQSNLR PA
0
1189-1209 (21) GTTEGVYYQAPDFLLDAATVR PA
0
1221-1236 (16) LPQQFQGDQLMAYGGK PA
0
1239-1261 (23) YSVAFYSLDGVGTSNFEPQVLIK PA
0
1268-1282 (15) QVIYMDAPAPENGVR PA
0
1283-1290 (8) QEQEVAMR PA
0
1296-1307 (12) YFNSVSEKPVTR PA
0
1308-1323 (16) EDFMSVLSDIEYILIK PA
0
1324-1334 (11) ASYGQGLQQSR PA
0
1335-1344 (10) ISDISMEVGR PA
0
1349-1382 (34) LHPEEEVASLLENCVCPPGTVGFSCQDCAPGYHR PA
0
1392-1418 (27) GPRPLVAPCVPCSCNNHSDTCDPNTGK PA
0
1419-1441 (23) CLNCGDNTAGDHCDVCTSGYYGK PA
0
1442-1475 (34) VTGSASDCALCACPHSPPASFSPTCVLEGDHDFR PA
0
1476-1486 (11) CDACLLGYEGK PA
0
1491-1508 (18) CSSSYYGNPQTPGGSCQK PA
0
1509-1523 (15) CDCNPHGSVHGDCDR PA
0
1524-1531 (8) TSGQCVCR PA
0
1546-1599 (54) HILMETDCVSCDDECVGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTK PA
0
1600-1607 (8) YLQESLLK PA
0
1619-1631 (13) LEGVAEETDNLQK PA
0
1653-1663 (11) ESQDLAIAIER PA
0
1664-1674 (11) LQMSITEIMEK PA
0
1675-1709 (35) TTLNQTLDEDFLLPNSTLQNMQQNGTSLLEIMQIR PA
0
1710-1723 (14) DFTQLHQNATLELK PA
0
1724-1747 (24) AAEDLLSQIQENYQKPLEELEVLK PA
0
1748-1756 (9) EAASHVLSK PA
0
1775-1790 (16) MQESNHLLLMVNANLR PA
0
1797-1814 (18) LHVQEEQNLTSELIVQGR PA
0
1815-1840 (26) GLIDAAAAQTDAVQDALEHLEDHQDK PA
0
1850-1862 (13) HHIDDLVMHMSQR PA
0
1863-1870 (8) NAVDLVYR PA
0
1871-1880 (10) AEDHAAEFQR PA
0
1881-1893 (13) LADVLYSGLENIR PA
0
1894-1921 (28) NVSLNATSAAYVHYNIQSLIEESEELAR PA
0
1926-1942 (17) TVTETSLLSESLVSNGK PA
0
1962-1973 (12) LPGIALELSELR PA
0
1979-1988 (10) FQENAVEITR PA
0
1989-1998 (10) QTNESLLILR PA
0
2013-2027 (15) ELATSASQSAVSTLR PA
0
2028-2045 (18) DVAGLSQELLNTSASLSR PA
0
2052-2069 (18) ETHQLLQDSTMATLLAGR PA
0
2073-2084 (12) DVEIQANLLFDR PA
0
2090-2097 (8) MLEENLSR PA
0
2129-2147 (19) AYQPQISSTNYNTLTLNVK PA
0
2148-2172 (25) TQEPDNLLFYLGSSTASDFLAVEMR PA
0
2176-2188 (13) VAFLWDLGSGSTR PA
0
2189-2200 (12) LEFPDFPIDDNR PA
0
2201-2208 (8) WHSIHVAR PA
0
2209-2218 (10) FGNIGSLSVK PA
0
2233-2258 (26) SPGTANVLDVNNSTLMFVGGLGGQIK PA
0
2270-2280 (11) GCLGEAFLNGK PA
0
2281-2290 (10) SIGLWNYIER PA
0
2296-2320 (25) GCFGSSQNEDPSFHFDGSGYSVVEK PA
0
2321-2351 (31) SLPATVTQIIMLFNTFSPNGLLLYLGSYGTK PA
0
2352-2360 (9) DFLSIELFR PA
0
2365-2380 (16) VMTDLGSGPITLLTDR PA
0
2382-2389 (8) YNNGTWYK PA
0
2398-2412 (15) QGVLAVIDAYNTSNK PA
0
2416-2428 (13) QGETPGASSDLNR PA
0
2432-2441 (10) DPIYVGGLPR PA
0
2480-2487 (8) GCLLEPIR PA
0
2494-2502 (9) GGYIELPPK PA
0
2503-2533 (31) SLSPESEWLVTFATTNSSGIILAALGGDVEK PA
0
2538-2567 (30) EEAHVPFFSVMLIGGNIEVHVNPGDGTGLR PA
0
2569-2590 (22) ALLHAPTGTCSDGQAHSISLVR PA
0
2594-2608 (15) IITVQLDENNPVEMK PA
0
2609-2616 (8) LGTLVESR PA
0
2617-2640 (24) TINVSNLYVGGIPEGEGTSLLTMR PA
0
2649-2680 (32) NLIFNLELLDFNSAVGHEQVDLDTCWLSERPK PA
0
2681-2689 (9) LAPDAEDSK PA
0
2696-2734 (39) AFPEQCVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVR PA
0
2737-2744 (8) LSVELSIR PA
0
2745-2772 (28) TFASSGLIYYMAHQNQADYAVLQLHGGR PA
0
2773-2781 (9) LHFMFDLGK PA
0
2786-2796 (11) VSHPALLSDGK PA
0
2809-2816 (8) GFITVDGR PA
0
2817-2848 (32) ESPMVTVVGDGTMLDVEGLFYLGGLPSQYQAR PA
0
2850-2869 (20) IGNITHSIPACIGDVTVNSK PA
0
2874-2884 (11) DSPVSAFTVNR PA
0
2885-2905 (21) CYAVAQEGTYFDGSGYAALVK PA
0
2910-2921 (12) VQSDVNITLEFR PA
0
2922-2936 (15) TSSQNGVLLGISTAK PA
0
2937-2948 (12) VDAIGLELVDGK PA
0
2949-2959 (11) VLFHVNNGAGR PA
0
2960-2967 (8) ITAAYEPK PA
0
2968-2976 (9) TATVLCDGK PA
0
2977-2984 (8) WHTLQANK PA
0
2989-3026 (38) ITLIVDGNAVGAESPHTQSTSVDTNNPIYVGGYPAGVK PA
0
3048-3058 (11) SPQVQSFDFSR PA
0
3059-3075 (17) AFELHGVFLHSCPGTES PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center