Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P25445-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MLGIWTLLPLVLTSVAR PA
6
22-33 (12) SVNAQVTDINSK PA
6
40-73 (34) TVTTVETQNLEGLHHDGQFCHKPCPPDVNMESSR PA
1
74-84 (11) NAHSPATPSAK PA
3
87-103 (17) DPDLTWGGFVFFFCQFH PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center