Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P28827-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-81 (79) GLGTCLATLAGLLLTAAGETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSDPWMPSGSFMLVNASGRPEGQR PA
1
82-90 (9) AHLLLPQLK PA
1
91-106 (16) ENDTHCIDFHYFVSSK PA
1
107-119 (13) SNSPPGLLNVYVK PA
1
120-138 (19) VNNGPLGNPIWNISGDPTR PA
1
143-176 (34) AELAISTFWPNFYQVIFEVITSGHQGYLAIDEVK PA
1
177-184 (8) VLGHPCTR PA
1
191-211 (21) IQNVEVNAGQFATFQCSAIGR PA
1
218-226 (9) LWLQGIDVR PA
1
241-252 (12) FIASFNVVNTTK PA
1
264-279 (16) TEGGVGISNYAELVVK PA
1
280-316 (37) EPPVPIAPPQLASVGATYLWIQLNANSINGDGPIVAR PA
1
317-330 (14) EVEYCTASGSWNDR PA
1
331-339 (9) QPVDSTSYK PA
1
340-371 (32) IGHLDPDTEYEISVLLTRPGEGGTGSPGPALR PA
1
400-409 (10) WEPFGYNVTR PA
1
410-430 (21) CHSYNLTVHYCYQVGGQEQVR PA
1
431-458 (28) EEVSWDTENSHPQHTITNLSPYTNVSVK PA
1
459-467 (9) LILMNPEGR PA
1
469-498 (30) ESQELIVQTDEDLPGAVPTESIQGSTFEEK PA
1
505-521 (17) EPTQTYGVITLYEITYK PA
1
522-538 (17) AVSSFDPEIDLSNQSGR PA
1
542-564 (23) LGNETHFLFFGLYPGTTYSFTIR PA
1
570-582 (13) GFGPPATNQFTTK PA
1
583-614 (32) ISAPSMPAYELETPLNQTDNTVTVMLKPAHSR PA
1
615-631 (17) GAPVSVYQIVVEEERPR PA
1
642-682 (41) CYPVPIHFQNASLLNSQYYFAAEFPADSLQAAQPFTIGDNK PA
1
683-696 (14) TYNGYWNTPLLPYK PA
1
700-707 (8) IYFQAASR PA
1
714-722 (9) IDCVQVATK PA
1
723-735 (13) GAATPKPVPEPEK PA
1
743-765 (23) IAGVIAGILLFVIIFLGVVLVMK PA
1
782-793 (12) QEMTVMVNSMDK PA
1
794-817 (24) SYAEQGTNCDEAFSFMDTHNLNGR PA
1
818-828 (11) SVSSPSSFTMK PA
1
829-862 (34) TNTLSTSVPNSYYPDETHTMASDTSSLVQSHTYK PA
0
865-881 (17) EPADVPYQTGQLHPAIR PA
1
882-893 (12) VADLLQHITQMK PA
3
894-901 (8) CAEGYGFK PA
1
902-919 (18) EEYESFFEGQSAPWDSAK PA
1
929-939 (11) YGNIIAYDHSR PA
5
942-984 (43) LQTIEGDTNSDYINGNYIDGYHRPNHYIATQGPMQETIYDFWR PA
1
985-1005 (21) MVWHENTASIIMVTNLVEVGR PA
1
1011-1020 (10) YWPDDTEIYK PA
1
1024-1038 (15) VTLIETELLAEYVIR PA
1
1055-1078 (24) QFHFTGWPDHGVPYHATGLLGFVR PA
1
1084-1101 (18) SPPSAGPLVVHCSAGAGR PA
1
1102-1117 (16) TGCFIVIDIMLDMAER PA
1
1118-1128 (11) EGVVDIYNCVR PA
1
1135-1168 (34) VNMVQTEEQYVFIHDAILEACLCGDTSVPASQVR PA
1
1169-1176 (8) SLYYDMNK PA
1
1177-1187 (11) LDPQTNSSQIK PA
3
1192-1201 (10) TLNMVTPTLR PA
1
1202-1212 (11) VEDCSIALLPR PA
1
1219-1227 (9) CMDILPPDR PA
1
1228-1252 (25) CLPFLITIDGESSNYINAALMDSYK PA
1
1253-1269 (17) QPSAFIVTQHPLPNTVK PA
1
1274-1306 (33) LVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHR PA
1
1307-1326 (20) HGPIQVEFVSADLEEDIISR PA
1
1330-1341 (12) IYNAARPQDGYR PA
1
1342-1355 (14) MVQQFQFLGWPMYR PA
1
1374-1384 (11) WQEEYNGGEGR PA
1
1385-1395 (11) TVVHCLNGGGR PA
3
1396-1410 (15) SGTFCAISIVCEMLR PA
1
1414-1422 (9) TVDVFHAVK PA
1
1426-1439 (14) NNKPNMVDLLDQYK PA
1
1440-1452 (13) FCYEVALEYLNSG PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center