Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P29074-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
25-44 (20) QHTEVVCNILLLDNTVQAFK PA
0
48-60 (13) HDQGQVLLDVVFK PA
0
61-83 (23) HLDLTEQDYFGLQLADDSTDNPR PA
0
84-92 (9) WLDPNKPIR PA
0
98-106 (9) GSPYSLNFR PA
0
109-116 (8) FFVSDPNK PA
0
124-131 (8) YQYFLQIK PA
0
139-186 (48) LPCPSNTAALLASFAVQSELGDYDQSENLSGYLSDYSFIPNQPQDFEK PA
0
191-212 (22) LHQQHIGLSPAEAEFNYLNTAR PA
0
213-225 (13) TLELYGVEFHYAR PA
0
226-245 (20) DQSNNEIMIGVMSGGILIYK PA
0
250-257 (8) MNTFPWLK PA
0
281-292 (12) ETLLGFNMVNYR PA
0
300-309 (10) ACVEHHTFFR PA
0
310-318 (9) LDRPLPPQK PA
0
319-330 (12) NFFAHYFTLGSK PA
0
337-346 (10) TEVQSVQYGK PA
0
358-365 (8) SPSKPLAR PA
0
367-375 (9) LMDWEVVSR PA
0
383-391 (9) LETQSLPSR PA
0
392-400 (9) SPPGTPNHR PA
0
401-410 (10) NSTFTQEGTR PA
0
411-436 (26) LRPSSVGHLVDHMVHTSPSEVFVNQR PA
0
437-468 (32) SPSSTQANSIVLESSPSQETPGDGKPPALPPK PA
0
473-519 (47) NSWNQIHYSHSQQDLESHINETFDIPSSPEKPTPNGGIPHDNLVLIR PA
0
520-527 (8) MKPDENGR PA
0
547-559 (13) VAPGTPADLCVPR PA
0
560-572 (13) LNEGDQVVLINGR PA
0
573-587 (15) DIAEHTHDQVVLFIK PA
0
593-613 (21) HSGELMLLVRPNAVYDVVEEK PA
0
614-626 (13) LENEPDFQYIPEK PA
0
627-640 (14) APLDSVHQDDHSLR PA
0
641-664 (24) ESMIQLAEGLITGTVLTQFDQLYR PA
0
666-675 (10) KPGMTMSCAK PA
0
687-695 (9) DISPYDATR PA
0
700-758 (59) GNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVER PA
0
763-795 (33) CHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFR PA
0
797-804 (8) MTLFNQEK PA
0
805-838 (34) NESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVR PA
0
845-858 (14) EEPVVVHCSAGIGR PA
0
859-885 (27) TGVLITMETAMCLIECNQPVYPLDIVR PA
0
892-902 (11) AMMIQTPSQYR PA
0
903-910 (8) FVCEAILK PA
0
911-926 (16) VYEEGFVKPLTTSTNK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center