Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P29597-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-29 (19) GSKPVGDGAQPMAAMGGLK PA
0
30-63 (34) VLLHWAGPGGGEPWVTFSESSLTAEEVCIHIAHK PA
0
64-95 (32) VGITPPCFNLFALFDAQAQVWLPPNHILEIPR PA
0
96-104 (9) DASLMLYFR PA
0
111-118 (8) NWHGMNPR PA
0
125-157 (33) CGPPGTEASSDQTAQGMQLLDPASFEYLFEQGK PA
0
158-180 (23) HEFVNDVASLWELSTEEEIHHFK PA
0
181-197 (17) NESLGMAFLHLCHLALR PA
0
198-207 (10) HGIPLEEVAK PA
0
250-258 (9) LSQQMVMVK PA
0
282-294 (13) LLAQAEGEPCYIR PA
0
295-335 (41) DSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNK PA
0
336-345 (10) EEGSSGSSGR PA
0
346-354 (9) NPQASLFGK PA
0
361-370 (10) AVGQPADRPR PA
0
371-381 (11) EPLWAYFCDFR PA
0
382-389 (8) DITHVVLK PA
0
390-397 (8) EHCVSIHR PA
0
402-410 (9) CLELSLPSR PA
0
411-425 (15) AAALSFVSLVDGYFR PA
0
426-442 (17) LTADSSHYLCHEVAPPR PA
0
449-463 (15) DGIHGPLLEPFVQAK PA
0
464-482 (19) LRPEDGLYLIHWSTSHPYR PA
0
483-490 (8) LILTVAQR PA
0
491-501 (11) SQAPDGMQSLR PA
0
505-521 (17) FPIEQQDGAFVLEGWGR PA
0
528-539 (12) ELGAALQGCLLR PA
0
540-548 (9) AGDDCFSLR PA
0
550-565 (16) CCLPQPGETSNLIIMR PA
0
573-583 (11) TLNLSQLSFHR PA
0
588-600 (13) EITQLSHLGQGTR PA
0
610-620 (11) VEGSGDPEEGK PA
0
621-631 (11) MDDEDPLVPGR PA
0
643-679 (37) VLDPSHHDIALAFYETASLMSQVSHTHLAFVHGVCVR PA
0
680-700 (21) GPENIMVTEYVEHGPLDVWLR PA
0
704-711 (8) GHVPMAWK PA
0
712-728 (17) MVVAQQLASALSYLENK PA
0
729-738 (10) NLVHGNVCGR PA
0
745-756 (12) LGLAEGTSPFIK PA
0
757-769 (13) LSDPGVGLGALSR PA
0
776-797 (22) IPWLAPECLPGGANSLSTAMDK PA
0
798-818 (21) WGFGATLLEICFDGEAPLQSR PA
0
833-860 (28) LPEPSCPQLATLTSQCLTYEPTQRPSFR PA
0
869-894 (26) LQPHNLADVLTVNPDSPASDPTVFHK PA
0
902-910 (9) DLGEGHFGK PA
1
911-930 (20) VSLYCYDPTNDGTGEMVAVK PA
0
934-941 (8) ADCGPQHR PA
0
953-961 (9) TLYHEHIIK PA
0
964-972 (9) GCCEDQGEK PA
0
973-987 (15) SLQLVMEYVPLGSLR PA
0
993-1022 (30) HSIGLAQLLLFAQQICEGMAYLHAQHYIHR PA
0
1028-1035 (8) NVLLDNDR PA
0
1039-1046 (8) IGDFGLAK PA
0
1047-1056 (10) AVPEGHEYYR PA
0
1059-1074 (16) EDGDSPVFWYAPECLK PA
0
1078-1107 (30) FYYASDVWSFGVTLYELLTHCDSSQSPPTK PA
0
1108-1123 (16) FLELIGIAQGQMTVLR PA
0
1140-1149 (10) CPCEVYHLMK PA
0
1150-1170 (21) NCWETEASFRPTFENLIPILK PA
0
1176-1187 (12) YQGQAPSVFSVC PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center