Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P30048-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
16-37 (22) HVSAIPWGISATAALRPAACGR PA
1
38-52 (15) TSLTNLLCSGSSQAK PA
0
53-73 (21) LFSTSSSCHAPAVTQHAPYFK PA
0
74-83 (10) GTAVVNGEFK PA
1
84-91 (8) DLSLDDFK PA
1
94-118 (25) YLVLFFYPLDFTFVCPTEIVAFSDK PA
1
119-148 (30) ANEFHDVNCEVVAVSVDSHFSHLAWINTPR PA
1
150-166 (17) NGGLGHMNIALLSDLTK PA
1
171-184 (14) DYGVLLEGSGLALR PA
1
185-196 (12) GLFIIDPNGVIK PA
1
197-207 (11) HLSVNDLPVGR PA
1
218-248 (31) AFQYVETHGEVCPANWTPDSPTIKPSPAASK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center