Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P30048-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
16-37 (22) HVSAIPWGISATAALRPAACGR PA
1
38-55 (18) TSLTNLLCSGSSQAPYFK PA
0
56-65 (10) GTAVVNGEFK PA
1
66-73 (8) DLSLDDFK PA
1
76-100 (25) YLVLFFYPLDFTFVCPTEIVAFSDK PA
1
101-130 (30) ANEFHDVNCEVVAVSVDSHFSHLAWINTPR PA
1
132-148 (17) NGGLGHMNIALLSDLTK PA
1
153-166 (14) DYGVLLEGSGLALR PA
1
167-178 (12) GLFIIDPNGVIK PA
1
179-189 (11) HLSVNDLPVGR PA
1
200-230 (31) AFQYVETHGEVCPANWTPDSPTIKPSPAASK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center