Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P30510-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-30 (23) TLILLLSGALALTETWACSHSMR PA
7
31-41 (11) YFSTSVSRPGR PA
2
46-59 (14) FIAVGYVDDTQFVR PA
39
60-68 (9) FDSDAASPR PA
39
73-86 (14) APWVEQEGPEYWDR PA
13
107-132 (26) GYYNQSEAGSHTLQWMFGCDLGPDGR PA
0
136-145 (10) GYDQSAYDGK PA
6
146-155 (10) DYIALNEDLR PA
37
156-169 (14) SWTAADTAAQITQR PA
16
182-193 (12) AYLEGTCVEWLR PA
30
211-226 (16) THVTHHPVSDHEATLR PA
17
227-267 (41) CWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQK PA
4
268-280 (13) WAAVVVPSGEEQR PA
53
281-297 (17) YTCHVQHEGLPEPLTLR PA
13
298-334 (37) WEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCR PA
4
342-365 (24) GGSCSQAASSNSAQGSDESLIACK PA
11
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center