Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P30939-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MDFLNSSDQNLTSEELLNR PA
0
24-52 (29) ILVSLTLSGLALMTTTINSLVIAAIIVTR PA
0
54-86 (33) LHHPANYLICSLAVTDFLVAVLVMPFSIVYIVR PA
0
87-121 (35) ESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDR PA
0
124-133 (10) AITDAVEYAR PA
0
139-162 (24) HAGIMITIVWIISVFISMPPLFWR PA
0
176-203 (28) HDHIVSTIYSTFGAFYIPLALILILYYK PA
0
223-236 (14) EEVNGQVLLESGEK PA
0
240-249 (10) SVSTSYVLEK PA
0
250-260 (11) SLSDPSTDFDK PA
0
291-312 (22) AATTLGLILGAFVICWLPFFVK PA
0
313-321 (9) ELVVNVCDK PA
0
324-355 (32) ISEEMSNFLAWLGYLNSLINPLIYTIFNEDFK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center