Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P31271-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MTASVLLHPR PA
0
11-33 (23) WIEPTVMFLYDNGGGLVADELNK PA
0
34-88 (55) NMEGAAAAAAAAAAAAAAGAGGGGFPHPAAAAAGGNFSVAAAAAAAAAAAANQCR PA
0
89-151 (63) NLMAHPAPLAPGAASAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSSGGPGPAGPAGAEAAK PA
0
152-183 (32) QCSPCSAAAQSSSGPAALPYGYFGSGYYPCAR PA
0
184-192 (9) MGPHPNAIK PA
0
193-209 (17) SCAQPASAAAAAAFADK PA
0
210-224 (15) YMDTAGPAAEEFSSR PA
0
227-265 (39) EFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESR PA
0
266-293 (28) HEPLGLPMESYQPWALPNGWNGQMYCPK PA
0
294-303 (10) EQAQPPHLWK PA
0
304-320 (17) STLPDVVSHPSDASSYR PA
0
355-364 (10) ISATTNLSER PA
1
365-373 (9) QVTIWFQNR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center