Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P32121-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MGEKPGTR PA
4
27-34 (8) DFVDHLDK PA
4
35-50 (16) VDPVDGVVLVDPDYLK PA
2
54-63 (10) VFVTLTCAFR PA
2
67-77 (11) EDLDVLGLSFR PA
4
79-100 (22) DLFIATYQAFPPVPNPPRPPTR PA
4
109-139 (31) LGQHAHPFFFTIPQNLPCSVTLQPGPEDTGK PA
3
140-148 (9) ACGVDFEIR PA
4
172-189 (18) VQFAPEKPGPQPSAETTR PA
4
197-206 (10) SLHLEASLDK PA
4
207-227 (21) ELYYHGEPLNVNVHVTNNSTK PA
4
238-251 (14) QYADICLFSTAQYK PA
4
252-271 (20) CPVAQLEQDDQVSPSSTFCK PA
4
272-283 (12) VYTITPLLSDNR PA
4
296-308 (13) HEDTNLASSTIVK PA
4
314-323 (10) EVLGILVSYR PA
4
333-393 (61) GGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFAR PA
2
401-409 (9) DDDYDDQLC PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center