Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P32121-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MGEKPGTR PA
4
27-34 (8) DFVDHLDK PA
4
35-50 (16) VDPVDGVVLVDPDYLK PA
2
54-63 (10) VFVTLTCAFR PA
2
67-77 (11) EDLDVLGLSFR PA
4
79-100 (22) DLFIATYQAFPPVPNPPRPPTR PA
4
109-121 (13) LGQHAHPFFFTVR PA
0
122-160 (39) MPLPSEGQGAGAGTVSGVGIPQNLPCSVTLQPGPEDTGK PA
0
161-169 (9) ACGVDFEIR PA
4
193-210 (18) VQFAPEKPGPQPSAETTR PA
4
218-227 (10) SLHLEASLDK PA
4
228-248 (21) ELYYHGEPLNVNVHVTNNSTK PA
4
259-272 (14) QYADICLFSTAQYK PA
4
273-292 (20) CPVAQLEQDDQVSPSSTFCK PA
4
293-304 (12) VYTITPLLSDNR PA
4
317-329 (13) HEDTNLASSTIVK PA
4
335-344 (10) EVLGILVSYR PA
4
354-414 (61) GGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFAR PA
2
422-430 (9) DDDYDDQLC PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center