Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P32780-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MATSSEEVLLIVK PA
0
20-30 (11) QDGALYLMAER PA
0
31-38 (8) IAWAPEGK PA
0
41-51 (11) FTISHMYADIK PA
0
63-87 (25) IQLQLVLHAGDTTNFHFSNESTAVK PA
0
94-102 (9) DLLQQLLPK PA
0
117-129 (13) MLQEDPVLFQLYK PA
1
130-146 (17) DLVVSQVISAEEFWANR PA
1
147-161 (15) LNVNATDSSSTSNHK PA
1
162-185 (24) QDVGISAAFLADVRPQTDGCNGLR PA
1
186-198 (13) YNLTSDIIESIFR PA
1
207-218 (12) YAENVPHNMTEK PA
1
224-232 (9) FFQSHYFHR PA
1
241-248 (8) DLFAECAK PA
1
256-263 (8) TMVSLGVK PA
1
264-293 (30) NPLLDLTALEDKPLDEGYGISSVPSASNSK PA
1
297-305 (9) ENSNAAIIK PA
1
307-320 (14) FNHHSAMVLAAGLR PA
1
322-350 (29) QEAQNEQTSEPSNMDGNSGDADCFQPAVK PA
1
354-365 (12) LQESIEYEDLGK PA
1
382-408 (27) YYHGPTPIQSLQYATSQDIINSFQSIR PA
1
409-417 (9) QEMEAYTPK PA
1
418-462 (45) LTQVLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELK PA
1
463-473 (11) HLYVAVGELLR PA
1
474-489 (16) HFWSCFPVNTPFLEEK PA
1
515-535 (21) QYLSTNLVSHIEEMLQTAYNK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center