Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P32780-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MLQEDPVLFQLYK PA
1
14-30 (17) DLVVSQVISAEEFWANR PA
1
31-45 (15) LNVNATDSSSTSNHK PA
1
46-69 (24) QDVGISAAFLADVRPQTDGCNGLR PA
1
70-82 (13) YNLTSDIIESIFR PA
1
91-102 (12) YAENVPHNMTEK PA
1
108-116 (9) FFQSHYFHR PA
1
125-132 (8) DLFAECAK PA
1
140-147 (8) TMVSLGVK PA
1
148-177 (30) NPLLDLTALEDKPLDEGYGISSVPSASNSK PA
1
181-189 (9) ENSNAAIIK PA
1
191-204 (14) FNHHSAMVLAAGLR PA
1
206-234 (29) QEAQNEQTSEPSNMDGNSGDADCFQPAVK PA
1
238-249 (12) LQESIEYEDLGK PA
1
266-292 (27) YYHGPTPIQSLQYATSQDIINSFQSIR PA
1
293-301 (9) QEMEAYTPK PA
1
302-346 (45) LTQVLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELK PA
1
347-357 (11) HLYVAVGELLR PA
1
358-373 (16) HFWSCFPVNTPFLEEK PA
1
399-419 (21) QYLSTNLVSHIEEMLQTAYNK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center