Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P35711-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MLTDPDLPQEFER PA
0
18-36 (19) RPASPYGEADGEVAMVTSR PA
3
39-81 (43) VEEEESDGLPAFHLPLHVSFPNKPHSEEFQPVSLLTQETCGHR PA
3
82-96 (15) TPTSQHNTMEVDGNK PA
3
97-112 (16) VMSSFAPHNSSTSPQK PA
3
119-134 (16) QSGESLSSTALGTPER PA
3
137-147 (11) GSLADVVDTLK PA
7
157-167 (11) NEPEETPSIEK PA
3
177-189 (13) LLAMGSGNFGEIK PA
3
190-198 (9) GTPESLAEK PA
7
201-213 (13) QLMGMINQLTSLR PA
3
214-224 (11) EQLLAAHDEQK PA
7
226-233 (8) LAASQIEK PA
7
243-250 (8) QQQEQIAR PA
7
251-261 (11) QQQQLLQQQHK PA
7
262-288 (27) INLLQQQIQVQGQLPPLMIPVFPPDQR PA
3
289-307 (19) TLAAAAQQGFLLPPGFSYK PA
3
308-356 (49) AGCSDPYPVQLIPTTMAAAAAATPGLGPLQLQQLYAAQLAAMQVSPGGK PA
3
357-378 (22) LPGIPQGNLGAAVSPTSIHTDK PA
3
379-386 (8) STNSPPPK PA
3
389-402 (14) DEVAQPLNLSAKPK PA
2
408-421 (14) SPTSPTSPHMPALR PA
3
422-430 (9) INSGAGPLK PA
3
431-443 (13) ASVPAALASPSAR PA
3
444-458 (15) VSTIGYLNDHDAVTK PA
3
473-480 (8) EQQVLDGK PA
3
481-493 (13) VAVVNSLGLNNCR PA
3
499-511 (13) TTLESLTQQLAVK PA
4
518-541 (24) FSHAMMDFNLSGDSDGSAGVSESR PA
4
550-557 (8) GSNEPHIK PA
4
558-568 (11) RPMNAFMVWAK PA
12
574-588 (15) ILQAFPDMHNSNISK PA
8
603-611 (9) QPYYEEQAR PA
9
658-716 (59) QYFNVGQQAQIPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSSSPEPGMPVIQSTYGVK PA
4
724-763 (40) EEIQAEDINGEIYDEYDEEEDDPDVDYGSDSENHIAGQAN PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center