Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P35711-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MHDEVAQPLNLSAKPK PA
0
22-35 (14) SPTSPTSPHMPALR PA
3
36-44 (9) INSGAGPLK PA
3
45-57 (13) ASVPAALASPSAR PA
3
58-72 (15) VSTIGYLNDHDAVTK PA
3
87-94 (8) EQQVLDGK PA
3
95-107 (13) VAVVNSLGLNNCR PA
3
113-125 (13) TTLESLTQQLAVK PA
4
132-155 (24) FSHAMMDFNLSGDSDGSAGVSESR PA
4
164-171 (8) GSNEPHIK PA
4
172-182 (11) RPMNAFMVWAK PA
12
188-202 (15) ILQAFPDMHNSNISK PA
8
217-225 (9) QPYYEEQAR PA
9
272-330 (59) QYFNVGQQAQIPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSSSPEPGMPVIQSTYGVK PA
4
338-377 (40) EEIQAEDINGEIYDEYDEEEDDPDVDYGSDSENHIAGQAN PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center