Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P35711-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-26 (19) RPASPYGEADGEVAMVTSR PA
3
29-71 (43) VEEEESDGLPAFHLPLHVSFPNKPHSEEFQPVSLLTQETCGHR PA
3
72-86 (15) TPTSQHNTMEVDGNK PA
3
87-102 (16) VMSSFAPHNSSTSPQK PA
3
109-124 (16) QSGESLSSTALGTPER PA
3
127-137 (11) GSLADVVDTLK PA
7
147-157 (11) NEPEETPSIEK PA
3
167-179 (13) LLAMGSGNFGEIK PA
3
180-188 (9) GTPESLAEK PA
7
191-203 (13) QLMGMINQLTSLR PA
3
204-214 (11) EQLLAAHDEQK PA
7
216-223 (8) LAASQIEK PA
7
233-240 (8) QQQEQIAR PA
7
241-251 (11) QQQQLLQQQHK PA
7
252-278 (27) INLLQQQIQVQGQLPPLMIPVFPPDQR PA
3
279-297 (19) TLAAAAQQGFLLPPGFSYK PA
3
298-346 (49) AGCSDPYPVQLIPTTMAAAAAATPGLGPLQLQQLYAAQLAAMQVSPGGK PA
3
347-368 (22) LPGIPQGNLGAAVSPTSIHTDK PA
3
369-376 (8) STNSPPPK PA
3
379-392 (14) DEVAQPLNLSAKPK PA
2
398-411 (14) SPTSPTSPHMPALR PA
3
412-420 (9) INSGAGPLK PA
3
421-433 (13) ASVPAALASPSAR PA
3
434-448 (15) VSTIGYLNDHDAVTK PA
3
463-470 (8) EQQVLDGK PA
3
471-483 (13) VAVVNSLGLNNCR PA
3
489-501 (13) TTLESLTQQLAVK PA
4
508-531 (24) FSHAMMDFNLSGDSDGSAGVSESR PA
4
540-547 (8) GSNEPHIK PA
4
548-558 (11) RPMNAFMVWAK PA
12
564-578 (15) ILQAFPDMHNSNISK PA
8
593-601 (9) QPYYEEQAR PA
9
648-706 (59) QYFNVGQQAQIPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSSSPEPGMPVIQSTYGVK PA
4
714-753 (40) EEIQAEDINGEIYDEYDEEEDDPDVDYGSDSENHIAGQAN PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center