Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P38405-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-42 (42) MGLCYSLRPLLFGGPGDDPCAASEPPVEDAQPAPAPALAPVR PA
0
56-67 (12) GGEGSPACARPK PA
0
78-86 (9) TEQLSAEER PA
0
122-132 (11) LLLLGAGESGK PA
16
141-152 (12) ILHVNGFNPEEK PA
1
165-191 (27) DAIVTIVSAMSTIIPPVPLANPENQFR PA
1
197-215 (19) SIAPITDFEYSQEFFDHVK PA
1
217-224 (8) LWDDEGVK PA
1
230-245 (16) SNEYQLIDCAQYFLER PA
1
246-263 (18) IDSVSLVDYTPTDQDLLR PA
1
266-275 (10) VLTSGIFETR PA
1
281-292 (12) VNFHMFDVGGQR PA
7
298-322 (25) WIQCFNDVTAIIYVAACSSYNMVIR PA
2
332-344 (13) ESLDLFESIWNNR PA
2
348-357 (10) TISIILFLNK PA
2
372-397 (26) IEDYFPEYANYTVPEDATPDAGEDPK PA
2
412-420 (9) ISTATGDGK PA
2
421-437 (17) HYCYPHFTCAVDTENIR PA
8
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center