Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P40818-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MPAVASVPK PA
1
10-18 (9) ELYLSSSLK PA
1
35-42 (8) SYVHSALK PA
0
66-74 (9) YVTVYNLIK PA
0
81-96 (16) QQQDYFHSILGPGNIK PA
0
144-151 (8) EDGGTLAK PA
1
152-161 (10) GSLENVLDSK PA
1
187-195 (9) ELYTMMTDK PA
1
196-205 (10) NISLIIMDAR PA
1
207-244 (38) MQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSK PA
1
251-266 (16) GNVEYVVLLDWFSSAK PA
1
267-275 (9) DLQIGTTLR PA
1
292-316 (25) NEPLVLEGGYENWLLCYPQYTTNAK PA
1
324-371 (48) QNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDENIELISGQNER PA
1
372-388 (17) MGPLNISTPVEPVAASK PA
1
389-402 (14) SDVSPIIQPVPSIK PA
1
425-439 (15) SESTNHEQQSPQSGK PA
1
445-462 (18) STKPVVFSPTLMLTDEEK PA
1
465-475 (11) IHAETALLMEK PA
1
507-517 (11) QEAEENEITEK PA
1
557-565 (9) SEHETSDAK PA
1
575-582 (8) CPTPEIQK PA
1
584-604 (21) STGDVPHTSVTGDSGSGKPFK PA
0
607-615 (9) GQPESGILR PA
0
621-628 (8) EDTDDTER PA
0
647-657 (11) IVPGLPSGWAK PA
1
658-667 (10) FLDPITGTFR PA
1
668-697 (30) YYHSPTNTVHMYPPEMAPSSAPPSTPPTHK PA
1
698-706 (9) AKPQIPAER PA
1
716-731 (16) SYSSPDITQAIQEEEK PA
1
733-742 (10) KPTVTPTVNR PA
1
743-751 (9) ENKPTCYPK PA
1
764-780 (17) NLNPVFGGSGPALTGLR PA
1
781-807 (27) NLGNTCYMNSILQCLCNAPHLADYFNR PA
1
808-816 (9) NCYQDDINR PA
1
824-835 (12) GEVAEEFGIIMK PA
1
836-843 (8) ALWTGQYR PA
1
857-886 (30) INDQFAGYSQQDSQELLLFLMDGLHEDLNK PA
1
895-905 (11) EENNDHLDDFK PA
1
906-913 (8) AAEHAWQK PA
1
916-931 (16) QLNESIIVALFQGQFK PA
1
932-941 (10) STVQCLTCHK PA
1
945-961 (17) TFEAFMYLSLPLASTSK PA
1
962-969 (8) CTLQDCLR PA
1
1003-1012 (10) LPPVLLVHLK PA
1
1024-1045 (22) LQTSVDFPLENLDLSQYVIGPK PA
1
1051-1073 (23) YNLFSVSNHYGGLDGGHYTAYCK PA
1
1083-1097 (15) FDDHEVSDISVSSVK PA
1
1098-1112 (15) SSAAYILFYTSLGPR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center