Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P40818-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MPAVASVPK PA
1
10-18 (9) ELYLSSSLK PA
1
67-74 (8) EDGGTLAK PA
1
75-84 (10) GSLENVLDSK PA
1
110-118 (9) ELYTMMTDK PA
1
119-128 (10) NISLIIMDAR PA
1
130-167 (38) MQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSK PA
1
174-189 (16) GNVEYVVLLDWFSSAK PA
1
190-198 (9) DLQIGTTLR PA
1
215-239 (25) NEPLVLEGGYENWLLCYPQYTTNAK PA
1
247-294 (48) QNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDENIELISGQNER PA
1
295-311 (17) MGPLNISTPVEPVAASK PA
1
312-325 (14) SDVSPIIQPVPSIK PA
1
348-362 (15) SESTNHEQQSPQSGK PA
1
368-385 (18) STKPVVFSPTLMLTDEEK PA
1
388-398 (11) IHAETALLMEK PA
1
430-440 (11) QEAEENEITEK PA
1
480-488 (9) SEHETSDAK PA
1
498-505 (8) CPTPEIQK PA
1
507-524 (18) STGDVPHTSVTGDSGSGK PA
0
541-551 (11) IVPGLPSGWAK PA
1
552-561 (10) FLDPITGTFR PA
1
562-591 (30) YYHSPTNTVHMYPPEMAPSSAPPSTPPTHK PA
1
592-600 (9) AKPQIPAER PA
1
610-625 (16) SYSSPDITQAIQEEEK PA
1
627-636 (10) KPTVTPTVNR PA
1
637-645 (9) ENKPTCYPK PA
1
658-674 (17) NLNPVFGGSGPALTGLR PA
1
675-701 (27) NLGNTCYMNSILQCLCNAPHLADYFNR PA
1
702-710 (9) NCYQDDINR PA
1
718-729 (12) GEVAEEFGIIMK PA
1
730-737 (8) ALWTGQYR PA
1
751-780 (30) INDQFAGYSQQDSQELLLFLMDGLHEDLNK PA
1
789-799 (11) EENNDHLDDFK PA
1
800-807 (8) AAEHAWQK PA
1
810-825 (16) QLNESIIVALFQGQFK PA
1
826-835 (10) STVQCLTCHK PA
1
839-855 (17) TFEAFMYLSLPLASTSK PA
1
856-863 (8) CTLQDCLR PA
1
897-906 (10) LPPVLLVHLK PA
1
918-939 (22) LQTSVDFPLENLDLSQYVIGPK PA
1
945-967 (23) YNLFSVSNHYGGLDGGHYTAYCK PA
1
977-991 (15) FDDHEVSDISVSSVK PA
1
992-1006 (15) SSAAYILFYTSLGPR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center