Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P42680-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MNFNTILEEILIK PA
0
36-44 (9) SMLTYYEGR PA
0
67-77 (11) NDDGVIPCQNK PA
0
78-99 (22) YPFQVVHDANTLYIFAPSPQSR PA
0
112-119 (8) NNNNIMIK PA
0
124-134 (11) FWTDGSYQCCR PA
0
146-154 (9) YNLFESSIR PA
0
156-164 (9) ALPPAPETK PA
0
167-199 (33) RPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLR PA
0
203-211 (9) GQEYLILEK PA
0
223-237 (15) YGNEGYIPSNYVTGK PA
0
239-250 (12) SNNLDQYEWYCR PA
0
274-288 (15) DSSQPGLYTVSLYTK PA
0
289-298 (10) FGGEGSSGFR PA
0
318-331 (14) HAFGSIPEIIEYHK PA
0
332-340 (9) HNAAGLVTR PA
0
351-362 (12) NAPTTAGFSYEK PA
0
363-374 (12) WEINPSELTFMR PA
0
375-385 (11) ELGSGLFGVVR PA
0
402-415 (14) EGAMCEEDFIEEAK PA
0
425-447 (23) LVQLYGVCTQQKPIYIVTEFMER PA
0
448-455 (8) GCLLNFLR PA
0
464-482 (19) DVLLSMCQDVCEGMEYLER PA
0
494-504 (11) NCLVSEAGVVK PA
0
505-512 (8) VSDFGMAR PA
0
513-526 (14) YVLDDQYTSSSGAK PA
0
531-541 (11) WCPPEVFNYSR PA
0
546-563 (18) SDVWSFGVLMWEVFTEGR PA
0
569-580 (12) YTNYEVVTMVTR PA
0
589-600 (12) LASNYVYEVMLR PA
0
601-617 (17) CWQEKPEGRPSFEDLLR PA
0
618-631 (14) TIDELVECEETFGR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center