Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P43355-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-72 (66) SLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTR PA
0
75-83 (9) QPSEGSSSR PA
0
84-99 (16) EEEGPSTSCILESLFR PA
0
106-116 (11) VADLVGFLLLK PA
0
126-134 (9) AEMLESVIK PA
2
138-146 (9) HCFPEIFGK PA
0
147-160 (14) ASESLQLVFGIDVK PA
0
161-191 (31) EADPTGHSYVLVTCLGLSYDGLLGDNQIMPK PA
0
192-227 (36) TGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGR PA
0
228-236 (9) EHSAYGEPR PA
0
238-247 (10) LLTQDLVQEK PA
0
253-261 (9) QVPDSDPAR PA
0
262-269 (8) YEFLWGPR PA
10
270-278 (9) ALAETSYVK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center