Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P45984-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-24 (19) CDSQFYSVQVADSTFTVLK PA
4
26-55 (30) YQQLKPIGSGAQGIVCAAFDTVLGINVAVK PA
4
57-68 (12) LSRPFQNQTHAK PA
12
84-96 (13) NIISLLNVFTPQK PA
7
97-127 (31) TLEEFQDVYLVMELMDANLCQVIHMELDHER PA
4
128-140 (13) MSYLLYQMLCGIK PA
13
141-150 (10) HLHSAGIIHR PA
13
151-160 (10) DLKPSNIVVK PA
13
167-174 (8) ILDFGLAR PA
24
175-189 (15) TACTNFMMTPYVVTR PA
4
193-203 (11) APEVILGMGYK PA
13
204-222 (19) ENVDIWSVGCIMAEMVLHK PA
1
229-236 (8) DYIDQWNK PA
7
237-250 (14) VIEQLGTPSAEFMK PA
3
258-265 (8) NYVENRPK PA
7
271-286 (16) FEELFPDWIFPSESER PA
3
301-308 (8) MLVIDPDK PA
3
310-317 (8) ISVDEALR PA
3
318-345 (28) HPYITVWYDPAEAEAPPPQIYDAQLEER PA
3
346-353 (8) EHAIEEWK PA
3
359-366 (8) EVMDWEER PA
3
374-382 (9) DQPSAQMQQ PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center