Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P45984-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-24 (19) CDSQFYSVQVADSTFTVLK PA
4
26-55 (30) YQQLKPIGSGAQGIVCAAFDTVLGINVAVK PA
4
57-68 (12) LSRPFQNQTHAK PA
12
84-96 (13) NIISLLNVFTPQK PA
7
97-127 (31) TLEEFQDVYLVMELMDANLCQVIHMELDHER PA
4
128-140 (13) MSYLLYQMLCGIK PA
13
141-150 (10) HLHSAGIIHR PA
13
151-160 (10) DLKPSNIVVK PA
13
167-174 (8) ILDFGLAR PA
24
175-189 (15) TACTNFMMTPYVVTR PA
4
193-203 (11) APEVILGMGYK PA
13
204-220 (17) ENVDIWSVGCIMGELVK PA
2
221-230 (10) GCVIFQGTDR PA
0
235-242 (8) DLGPAMLS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center