Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P47211-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-60 (60) MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR PA
0
68-109 (42) STTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICK PA
0
110-133 (24) FIHYFFTVSMLVSIFTLAAMSVDR PA
0
134-141 (8) YVAIVHSR PA
0
151-180 (30) NALLGVGCIWALSIAMASPVAYHQGLFHPR PA
0
181-195 (15) ASNQTFCWEQWPDPR PA
0
199-222 (24) AYVVCTFVFGYLLPLLLICFCYAK PA
0
245-285 (41) TAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFR PA
0
286-311 (26) ITAHCLAYSNSSVNPIIYAFLSENFR PA
0
325-332 (8) DSHLSDTK PA
0
338-349 (12) IDTPPSTNCTHV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center