Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P48595-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MDSLATSINQFALELSK PA
0
19-26 (8) LAESAQGK PA
0
27-47 (21) NIFFSSWSISTSLTIVYLGAK PA
0
48-62 (15) GTTAAQMAQVLQFNR PA
0
78-109 (32) MEFNLSNSEEIHSDFQTLISEILKPNDDYLLK PA
0
110-118 (9) TANAIYGEK PA
0
132-151 (20) TYFGAEPQPVNFVEASDQIR PA
0
153-160 (8) DINSWVER PA
0
166-180 (15) IQNLLPDDSVDSTTR PA
0
181-190 (10) MILVNALYFK PA
0
191-208 (18) GIWEHQFLVQNTTEKPFR PA
0
209-223 (15) INETTSKPVQMMFMK PA
0
226-235 (10) LHIFHIEKPK PA
0
236-244 (9) AVGLQLYYK PA
0
247-266 (20) DLSLLILLPEDINGLEQLEK PA
0
273-293 (21) LNEWTSADMMELYEVQLHLPK PA
0
296-303 (8) LEDSYDLK PA
0
304-319 (16) STLSSMGMSDAFSQSK PA
0
320-329 (10) ADFSGMSSAR PA
0
330-339 (10) NLFLSNVFHK PA
0
340-362 (23) AFVEINEQGTEAAAGSGSEIDIR PA
0
365-381 (17) VPSIEFNANHPFLFFIR PA
0
385-393 (9) TNTILFYGR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center