Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P49023-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MDDLDALLADLESTTSHISK PA
2
21-75 (55) RPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSR PA
2
76-93 (18) FIHQQPQSSSPVYGSSAK PA
2
94-110 (17) TSSVSNPQDSVGSPCSR PA
2
111-123 (13) VGEEEHVYSFPNK PA
2
126-147 (22) SAEPSPTVMSTSLGSNLSELDR PA
2
148-193 (46) LLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGK PA
3
209-247 (39) GLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQR PA
3
248-256 (9) VTSTQQQTR PA
3
257-264 (8) ISASSATR PA
3
265-277 (13) ELDELMASLSDFK PA
3
284-313 (30) TGSSSPPGGPPKPGSQLDSMLGSLQSDLNK PA
3
314-321 (8) LGVATVAK PA
3
329-341 (13) KPIAGQVVTAMGK PA
3
342-360 (19) TWHPEHFVCTHCQEEIGSR PA
3
366-373 (8) DGQPYCEK PA
3
374-382 (9) DYHNLFSPR PA
3
383-393 (11) CYYCNGPILDK PA
3
401-424 (24) TWHPEHFFCAQCGAFFGPEGFHEK PA
3
433-441 (9) DYFDMFAPK PA
3
448-469 (22) AILENYISALNTLWHPECFVCR PA
3
470-496 (27) ECFTPFVNGSFFEHDGQPYCEVHYHER PA
3
498-511 (14) GSLCSGCQKPITGR PA
3
520-532 (13) FHPEHFVCAFCLK PA
3
541-554 (14) EQNDKPYCQNCFLK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center