Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P49023-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MDDLDALLADLESTTSHISK PA
2
21-75 (55) RPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSR PA
2
76-93 (18) FIHQQPQSSSPVYGSSAK PA
2
94-110 (17) TSSVSNPQDSVGSPCSR PA
2
111-123 (13) VGEEEHVYSFPNK PA
2
126-147 (22) SAEPSPTVMSTSLGSNLSELDR PA
2
148-193 (46) LLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGK PA
3
209-247 (39) GLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQR PA
3
248-256 (9) VTSTQQQTR PA
3
257-264 (8) ISASSATR PA
3
265-277 (13) ELDELMASLSDFK PA
3
278-300 (23) GSWPLEEVVLLVSISSSVQEGEK PA
0
301-308 (8) YPHPCAAR PA
0
316-331 (16) SPDQPPPCPQFMAQGK PA
0
332-361 (30) TGSSSPPGGPPKPGSQLDSMLGSLQSDLNK PA
3
362-369 (8) LGVATVAK PA
3
377-389 (13) KPIAGQVVTAMGK PA
3
390-408 (19) TWHPEHFVCTHCQEEIGSR PA
3
414-421 (8) DGQPYCEK PA
3
422-430 (9) DYHNLFSPR PA
3
431-441 (11) CYYCNGPILDK PA
3
449-472 (24) TWHPEHFFCAQCGAFFGPEGFHEK PA
3
481-489 (9) DYFDMFAPK PA
3
496-517 (22) AILENYISALNTLWHPECFVCR PA
3
518-544 (27) ECFTPFVNGSFFEHDGQPYCEVHYHER PA
3
546-559 (14) GSLCSGCQKPITGR PA
3
568-580 (13) FHPEHFVCAFCLK PA
3
589-602 (14) EQNDKPYCQNCFLK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center