Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P49023-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MSTSLGSNLSELDR PA
0
15-60 (46) LLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGK PA
3
76-114 (39) GLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQR PA
3
115-123 (9) VTSTQQQTR PA
3
124-131 (8) ISASSATR PA
3
132-144 (13) ELDELMASLSDFK PA
3
151-180 (30) TGSSSPPGGPPKPGSQLDSMLGSLQSDLNK PA
3
181-188 (8) LGVATVAK PA
3
196-208 (13) KPIAGQVVTAMGK PA
3
209-227 (19) TWHPEHFVCTHCQEEIGSR PA
3
233-240 (8) DGQPYCEK PA
3
241-249 (9) DYHNLFSPR PA
3
250-260 (11) CYYCNGPILDK PA
3
268-291 (24) TWHPEHFFCAQCGAFFGPEGFHEK PA
3
300-308 (9) DYFDMFAPK PA
3
315-336 (22) AILENYISALNTLWHPECFVCR PA
3
337-363 (27) ECFTPFVNGSFFEHDGQPYCEVHYHER PA
3
365-378 (14) GSLCSGCQKPITGR PA
3
387-399 (13) FHPEHFVCAFCLK PA
3
408-421 (14) EQNDKPYCQNCFLK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center