Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P49761-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
9-19 (11) SPEPDPYLSYR PA
3
76-88 (13) SPSFGEDYYGPSR PA
3
117-124 (8) SCSSASSR PA
2
148-155 (8) IGDWLQER PA
2
156-169 (14) YEIVGNLGEGTFGK PA
1
170-178 (9) VVECLDHAR PA
1
217-241 (25) FLCVLMSDWFNFHGHMCIAFELLGK PA
2
249-261 (13) ENNFQPYPLPHVR PA
2
262-272 (11) HMAYQLCHALR PA
2
273-304 (32) FLHENQLTHTDLKPENILFVNSEFETLYNEHK PA
2
318-338 (21) VADFGSATFDHEHHTTIVATR PA
2
339-369 (31) HYRPPEVILELGWAQPCDVWSIGCILFEYYR PA
2
370-380 (11) GFTLFQTHENR PA
2
381-388 (8) EHLVMMEK PA
2
389-400 (12) ILGPIPSHMIHR PA
2
410-422 (13) GGLVWDENSSDGR PA
2
433-450 (18) SYMLQDSLEHVQLFDLMR PA
2
452-460 (9) MLEFDPAQR PA
2
461-480 (20) ITLAEALLHPFFAGLTPEER PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center