Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P49761-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-19 (10) ELADHAGSGR PA
0
21-28 (8) SGPSPTAR PA
0
29-37 (9) SGPHLSALR PA
0
56-78 (23) DTAGGGPGQARPLGPPGTSLLGR PA
0
83-97 (15) SGEGWCPGAFESGAR PA
0
123-131 (9) AEVAAGSGR PA
0
135-153 (19) SGEWGLAAAGAWETMHHCK PA
0
157-167 (11) SPEPDPYLSYR PA
3
224-236 (13) SPSFGEDYYGPSR PA
3
265-272 (8) SCSSASSR PA
2
296-303 (8) IGDWLQER PA
2
304-317 (14) YEIVGNLGEGTFGK PA
1
318-326 (9) VVECLDHAR PA
1
365-389 (25) FLCVLMSDWFNFHGHMCIAFELLGK PA
2
397-409 (13) ENNFQPYPLPHVR PA
2
410-420 (11) HMAYQLCHALR PA
2
421-452 (32) FLHENQLTHTDLKPENILFVNSEFETLYNEHK PA
2
466-486 (21) VADFGSATFDHEHHTTIVATR PA
2
487-517 (31) HYRPPEVILELGWAQPCDVWSIGCILFEYYR PA
2
518-528 (11) GFTLFQTHENR PA
2
529-536 (8) EHLVMMEK PA
2
537-548 (12) ILGPIPSHMIHR PA
2
558-570 (13) GGLVWDENSSDGR PA
2
581-598 (18) SYMLQDSLEHVQLFDLMR PA
2
600-608 (9) MLEFDPAQR PA
2
609-628 (20) ITLAEALLHPFFAGLTPEER PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center