Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P50221-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MDPAASSCMR PA
1
11-23 (13) SLQPPAPVWGCLR PA
1
24-102 (79) NPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDAR PA
1
104-114 (11) RPNSGPAGGSK PA
1
115-146 (32) EMGTSSLGLVDTTGGPGDDYGVLGSTANETEK PA
1
154-162 (9) ESSDNQENR PA
1
163-170 (8) GKPEGSSK PA
1
185-198 (14) ELEAEFAHHNYLTR PA
2
202-213 (12) YEIAVNLDLSER PA
1
231-254 (24) GGQPISPNGQDPEDGDSTASPSSE PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center