Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P50221-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MDPAASSCMR PA
1
11-23 (13) SLQPPAPVWGCLR PA
1
24-102 (79) NPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDAR PA
1
104-114 (11) RPNSGPAGGSK PA
1
115-146 (32) EMGTSSLGLVDTTGGPGDDYGVLGSTANETEK PA
1
154-165 (12) ESSGQSVVPEPK PA
0
166-174 (9) DEVEACEGR PA
0
175-184 (10) SAHLPQWAGP PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center