Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P50539-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-21 (10) LLEAAEFLER PA
0
25-41 (17) ECEHGYASSFPSMPSPR PA
0
42-49 (8) LQHSKPPR PA
3
57-69 (13) HSSGSSNTSTANR PA
3
70-77 (8) STHNELEK PA
2
92-102 (11) VLIPLGPDCTR PA
3
103-111 (9) HTTLGLLNK PA
3
126-135 (10) SQHQLENLER PA
3
144-155 (12) LEQLQGPQEMER PA
3
158-169 (12) MDSIGSTISSDR PA
3
175-223 (49) EEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center