Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P50539-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-13 (8) LQHSKPPR PA
3
21-33 (13) HSSGSSNTSTANR PA
3
34-41 (8) STHNELEK PA
2
56-66 (11) VLIPLGPDCTR PA
3
67-75 (9) HTTLGLLNK PA
3
90-99 (10) SQHQLENLER PA
3
108-119 (12) LEQLQGPQEMER PA
3
122-133 (12) MDSIGSTISSDR PA
3
139-187 (49) EEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center