Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P50539-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-48 (36) CEGAGLAPAAPPAVPPAVAAPQPPALPEDPAGAKPR PA
0
49-64 (16) CPFSDIFNTSENSMEK PA
0
65-88 (24) HINTFLQNVQILLEAASYLEQIEK PA
0
93-108 (16) CEHGYASSFPSMPSPR PA
0
109-116 (8) LQHSKPPR PA
3
124-136 (13) HSSGSSNTSTANR PA
3
137-144 (8) STHNELEK PA
2
159-169 (11) VLIPLGPDCTR PA
3
170-178 (9) HTTLGLLNK PA
3
193-202 (10) SQHQLENLER PA
3
211-222 (12) LEQLQGPQEMER PA
3
225-236 (12) MDSIGSTISSDR PA
3
242-290 (49) EEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center