Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_P50539-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-13 (8) LQHSKPPR PA
3
21-33 (13) HSSGSSNTSTANR PA
3
46-56 (11) VLIPLGPDCTR PA
3
57-65 (9) HTTLGLLNK PA
3
80-89 (10) SQHQLENLER PA
3
98-109 (12) LEQLQGPQEMER PA
3
112-123 (12) MDSIGSTISSDR PA
3
129-177 (49) EEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center